Additional information
| Physical Appearance | Fine White Lyophilized Powder |
|---|---|
| Residue Sequence | TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA |
| Solubility | 100 μg/mL sterile diluent (distilled de-ionized water) |
| Source | Biosynthetic production |
| Stability | Lyophilized protein is to be stored at -20°C. It is recommended to aliquot the reconstituted (dissolved) protein into several discrete vials in order to avoid repeated freezing and thawing. Reconstituted protein can be stored at 4°C. |
| Molar Mass | 7371.4 g/mol |
| CAS Number | 112603-35-7 |
| Molecular Formula | C319H501N91O96S7 |
| MG | 2 MG |
| Options container | container2 |
