Sale!

IGF-1 DES 1,3 1mg

$99.99 $69.99

-30%

In stock

Hurry! This sale ends in
SKU: 30022 Categories: ,
Only 14 items left in stock!

Free Canada Wide shipping on all orders over $199

  • 30 days easy returns
  • Order yours before 2.30pm for same day dispatch
Guaranteed Safe Checkout

Additional information

Physical Appearance

Fine White Lyophilized Powder

Residue Sequence

TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA

Solubility

100 μg/mL sterile diluent (distilled de-ionized water)

Source

Biosynthetic production

Stability

Lyophilized protein is to be stored at -20°C. It is recommended to aliquot the reconstituted (dissolved) protein into several discrete vials in order to avoid repeated freezing and thawing. Reconstituted protein can be stored at 4°C.

Molar Mass

7371.4 g/mol

CAS Number

112603-35-7

Molecular Formula

C319H501N91O96S7

MG

2 MG

Options container

container2