Additional information
Physical Appearance | Fine White Lyophilized Powder |
---|---|
Residue Sequence | TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA |
Solubility | 100 μg/mL sterile diluent (distilled de-ionized water) |
Source | Biosynthetic production |
Stability | Lyophilized protein is to be stored at -20°C. It is recommended to aliquot the reconstituted (dissolved) protein into several discrete vials in order to avoid repeated freezing and thawing. Reconstituted protein can be stored at 4°C. |
Molar Mass | 7371.4 g/mol |
CAS Number | 112603-35-7 |
Molecular Formula | C319H501N91O96S7 |
MG | 2 MG |
Options container | container2 |